DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and CHP1

DIOPT Version :10

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_009167.1 Gene:CHP1 / 11261 HGNCID:17433 Length:195 Species:Homo sapiens


Alignment Length:129 Identity:29/129 - (22%)
Similarity:50/129 - (38%) Gaps:36/129 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 DRISMNITQDGR-SVSPEAWMRLFCVF-----------FNG-----SLQERMKFAFEVYTSGGAV 126
            |||......:|. .|:...:||....|           .||     |...::.|||.:|......
Human    64 DRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDE 128

  Fly   127 VLNRE--------VVGVAIEQFFTGDDDDEVNELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQ 182
            .::|:        :|||.|       .|:::..: ||.   ...:.|.|.|..|:|.|:.::::
Human   129 KISRDELLQVLRMMVGVNI-------SDEQLGSI-ADR---TIQEADQDGDSAISFTEFVKVLE 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 111..182 CDD:463900 18/78 (23%)
CHP1NP_009167.1 Necessary for association with microtubule and interaction with GAPDH. /evidence=ECO:0000250 2..6
FRQ1 27..182 CDD:444056 29/129 (22%)
Nuclear export signal 1. /evidence=ECO:0000250 138..147 3/8 (38%)
Necessary for nuclear export signal 143..185 13/50 (26%)
Nuclear export signal 2. /evidence=ECO:0000250 176..185 0/6 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.