DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15177 and CBL2

DIOPT Version :10

Sequence 1:NP_649672.1 Gene:CG15177 / 40810 FlyBaseID:FBgn0037461 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_200410.1 Gene:CBL2 / 835697 AraportID:AT5G55990 Length:226 Species:Arabidopsis thaliana


Alignment Length:153 Identity:37/153 - (24%)
Similarity:68/153 - (44%) Gaps:36/153 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LFNVANVQVIERSL-------LAITKDTKYVSPRAWVD-LFELYTTE------------------ 109
            ||...:..||:..|       ||:.|..|..|  .:.| :|:|:.|:                  
plant    53 LFKKISSAVIDDGLINKEEFQLALFKTNKKES--LFADRVFDLFDTKHNGILGFEEFARALSVFH 115

  Fly   110 ---DLERRMKFAFEVYDTKNTGVIDREQVGVACEKFFHEG--DDEDELIELRADMTEFIMKKFDV 169
               .::.::.|:|::||.|..|.|:|::|.........|.  :.:|.:||   |:.:...::.|.
plant   116 PNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLKDTVIE---DIIDKTFEEADT 177

  Fly   170 DKDGVISFEDYSSVVSQQPVLVE 192
            ..||.|..|::.|:|.:.|.|::
plant   178 KHDGKIDKEEWRSLVLRHPSLLK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15177NP_649672.1 EF-hand_7 112..185 CDD:463900 20/74 (27%)
CBL2NP_200410.1 FRQ1 64..192 CDD:444056 30/132 (23%)

Return to query results.
Submit another query.