DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15177 and Kcnip4

DIOPT Version :10

Sequence 1:NP_649672.1 Gene:CG15177 / 40810 FlyBaseID:FBgn0037461 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_852030.1 Gene:Kcnip4 / 259243 RGDID:708539 Length:250 Species:Rattus norvegicus


Alignment Length:132 Identity:33/132 - (25%)
Similarity:50/132 - (37%) Gaps:29/132 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 EDLERRMKFAFEVYDT-----KN---TGVIDREQVGVACEKFFHEGDDEDELIELRADMTEFIMK 165
            |.||.:.||..:....     ||   :||::.|.......:||.:||.        .....|:..
  Rat    74 ELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDS--------TTYAHFLFN 130

  Fly   166 KFDVDKDGVISFEDYSSVVS--QQPVLVEFLGWLF-----------PSNEERDLMAHVINMDSML 217
            .||.|.:|.:||||:...:|  .:..:.|.|.|.|           ...|..|:|..:.:|....
  Rat   131 AFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKC 195

  Fly   218 NY 219
            .|
  Rat   196 TY 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15177NP_649672.1 EF-hand_7 112..185 CDD:463900 21/80 (26%)
Kcnip4NP_852030.1 KIS. /evidence=ECO:0000250 2..44
EF-hand_8 99..146 CDD:404678 16/54 (30%)
FRQ1 <128..235 CDD:444056 18/70 (26%)
Interaction with KCND2. /evidence=ECO:0000250|UniProtKB:Q8R426 237..250
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.