DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15177 and CIB4

DIOPT Version :10

Sequence 1:NP_649672.1 Gene:CG15177 / 40810 FlyBaseID:FBgn0037461 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_011530816.1 Gene:CIB4 / 130106 HGNCID:33703 Length:201 Species:Homo sapiens


Alignment Length:178 Identity:35/178 - (19%)
Similarity:62/178 - (34%) Gaps:47/178 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 RSYDPPTIGH-------MPGYRDNSDVSPASSVMTVVGGE----NGPRIKSEASPSYQLRPNWNP 381
            |:|....:.|       :..|:.....||.:|:..::..:    ...::|||         |...
Human  1999 RNYSQSKMAHSRTSTPLLQQYQVALSASPLTSLPRLLDAKGIILEEMKVKSE---------NLKE 2054

  Fly   382 SPSVTSYESDPPSSVTQETNLPITSIPPVS--VP-------ASANC--------------TPSPS 423
            .|.  |.|.:..|||...|.:....:.|.:  :|       :...|              ||:|:
Human  2055 EPQ--SSEEESMSSVETRTLIKSEPVSPKNGVLPQATGDQKSGGKCETDRRMVAARTEPLTPNPA 2117

  Fly   424 ETPKPRAQDAGKARSS-VPSKIPRQIPQFKTKRNNSKTKRPHAPGGKA 470
             :.|||....|...|| ..|...|.....::..::|.:...|:..|.:
Human  2118 -SKKPRVHKRGSESSSDSDSDSERSSCSSRSSSSSSSSSCSHSRSGSS 2164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15177NP_649672.1 EF-hand_7 112..185 CDD:463900
CIB4XP_011530816.1 EF-hand_7 117..184 CDD:463900
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.