DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and CNB1

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_012731.1 Gene:CNB1 / 853644 SGDID:S000001673 Length:175 Species:Saccharomyces cerevisiae


Alignment Length:158 Identity:32/158 - (20%)
Similarity:61/158 - (38%) Gaps:45/158 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KFSKANGPQCKQMTKKQFYQIFLVLFNVASVQVIERTLLAITKDTKYVSPRAWIHLFDLYTTNDI 111
            :|.|.:......:.|.:|..|..|..|..:.:::|                    :||...:.|:
Yeast    29 RFMKLDRDSSGSIDKNEFMSIPGVSSNPLAGRIME--------------------VFDADNSGDV 73

  Fly   112 QV------------------RMRFAFEVYDTKGTGVIDREQVGTACEKFFYGE--DEDELNELKA 156
            ..                  ::||||::||....|.|...::.... |...|.  |:::|.:: .
Yeast    74 DFQEFITGLSIFSGRGSKDEKLRFAFKIYDIDKDGFISNGELFIVL-KIMVGSNLDDEQLQQI-V 136

  Fly   157 DMTEFLMKKFDLDKDGVISYEDYSTVVE 184
            |.|   :.:.|.|.||.:|:|::...:|
Yeast   137 DRT---IVENDSDGDGRLSFEEFKNAIE 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 20/65 (31%)
EFh 116..178 CDD:238008 19/63 (30%)
CNB1NP_012731.1 FRQ1 4..161 CDD:227455 31/156 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.