DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and SOS3

DIOPT Version :10

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_197815.1 Gene:SOS3 / 832494 AraportID:AT5G24270 Length:222 Species:Arabidopsis thaliana


Alignment Length:113 Identity:32/113 - (28%)
Similarity:54/113 - (47%) Gaps:22/113 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 IQVRMRFAFEVYDTKGTGVIDREQVGTACEKFFYGEDEDELNELKADMTEFLMKK----FDLDKD 171
            :..:::|||::||.:.||.|:||::........:   |.|| .|..||.|.::.|    .|...|
plant   109 VHEKVKFAFKLYDLRQTGFIEREELKEMVVALLH---ESEL-VLSEDMIEVMVDKAFVQADRKND 169

  Fly   172 GVISYEDYSTVVEQQPILVE--FLGWL------FPS------KEDKDL 205
            |.|..:::...|...|.|::  .|.:|      |||      :|:.:|
plant   170 GKIDIDEWKDFVSLNPSLIKNMTLPYLKDINRTFPSFVSSCEEEEMEL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 114..179 CDD:463900 22/68 (32%)
SOS3NP_197815.1 FRQ1 53..181 CDD:444056 22/75 (29%)

Return to query results.
Submit another query.