DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and CBL3

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001320073.1 Gene:CBL3 / 828764 AraportID:AT4G26570 Length:230 Species:Arabidopsis thaliana


Alignment Length:195 Identity:49/195 - (25%)
Similarity:80/195 - (41%) Gaps:51/195 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 CLLVVYYKFSKANG-PQCKQMTKKQFYQIFLV-----LFNVASVQVIERTL-------LAITKDT 91
            |..:..||.|...| |:.  :.::..:.:..:     ||...|..||:..|       ||:.|..
plant    18 CFDIDIYKQSGGLGDPEL--LARETVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTN 80

  Fly    92 KYVS---PRAWIHLFDLYTTN---------------------DIQVRMRFAFEVYDTKGTGVIDR 132
            |..|   .|....:|||:.|.                     .|:.::.|:|::||.|..|.|:|
plant    81 KKESLFADRYQSQVFDLFDTKHNGILGFEEFARALSVFHPNAPIEDKIDFSFQLYDLKQQGFIER 145

  Fly   133 EQ-----VGTACEKFFYGED-EDELNELKADMTEFLMKKFDLDKDGVISYEDYSTVVEQQPILVE 191
            ::     |.|..|.   |.: .||:.|...|.|   .::.|...||.|..|::.|:|.:.|.|::
plant   146 QEVKQMVVATLAES---GMNLSDEIIESIIDKT---FEEADTKHDGRIDKEEWRTLVLRHPSLLK 204

  Fly   192  191
            plant   205  204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 22/69 (32%)
EFh 116..178 CDD:238008 21/67 (31%)
CBL3NP_001320073.1 EFh_PEF 40..202 CDD:330173 42/167 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.