DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and CBL6

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001328805.1 Gene:CBL6 / 827330 AraportID:AT4G16350 Length:226 Species:Arabidopsis thaliana


Alignment Length:116 Identity:30/116 - (25%)
Similarity:52/116 - (44%) Gaps:15/116 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LFNVASVQVIERTLLAITKDTKYVSPRAWIHLFDLYTTNDIQVRMRFA---FEVYDTKGTGVIDR 132
            :|.|..::.:.....:|:|:......:..:.||.:.||     |..||   |:::|||.||::|.
plant    39 VFTVNEIEALYELFKSISKNGLIDKEQFQLVLFKMNTT-----RSLFADRVFDLFDTKNTGILDF 98

  Fly   133 EQVGTACEKFFYGEDEDELNELKADMTEFLMKKFDLDKDGVISYEDYSTVV 183
            |....:...|       ..|....|..||..|.:||::.|.|..::...:|
plant    99 EAFARSLSVF-------HPNAKFEDKIEFSFKLYDLNQQGYIKRQEVKQMV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 20/66 (30%)
EFh 116..178 CDD:238008 20/64 (31%)
CBL6NP_001328805.1 FRQ1 38..192 CDD:227455 30/116 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.