DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and Cib1

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_038948271.1 Gene:Cib1 / 81823 RGDID:620133 Length:203 Species:Rattus norvegicus


Alignment Length:202 Identity:48/202 - (23%)
Similarity:92/202 - (45%) Gaps:42/202 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LTSEL--SQTDITCL-----LVVYYKFSKANGPQCKQM-----TKKQFYQIFLVLFNVASVQVIE 81
            |:.||  ...|:|.|     |:.:.:|.:...|:.:.:     |:..|.|| |.|..:.:....|
  Rat     8 LSKELLAEYQDLTFLTKQEILLAHRRFCELLPPEHRTVEESLHTRVSFEQI-LSLPELKANPFKE 71

  Fly    82 RTLLAI----TKDTKYVSPRAWIHLFDLYT-TNDIQVRMRFAFEVYDTKGTGVIDREQVG--TAC 139
            |..:..    |:|:  :|...::.|..::: |....::..:||.::|....|.:|||.:.  ..|
  Rat    72 RICMVFSTSPTRDS--LSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLDREDLSRLVNC 134

  Fly   140 EKFFYGEDED---ELNELKADMTEFLMKKFDLDKDGVISYEDYSTVVEQQP----------IL-- 189
               ..||.||   ..:|:| .:.:.::::.|:|:||.|:..::..|:.:.|          ||  
  Rat   135 ---LTGEGEDTRLSASEMK-QLIDNILEESDIDRDGTINLSEFQHVISRSPDFARCDRSACILST 195

  Fly   190 -VEFLGW 195
             :..|||
  Rat   196 HLSTLGW 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 19/68 (28%)
EFh 116..178 CDD:238008 19/66 (29%)
Cib1XP_038948271.1 EFh 111..178 CDD:238008 20/70 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.