DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and 1700109H08Rik

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_084119.1 Gene:1700109H08Rik / 77036 MGIID:1924286 Length:210 Species:Mus musculus


Alignment Length:216 Identity:53/216 - (24%)
Similarity:86/216 - (39%) Gaps:20/216 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MENSRFAALYGSLIKELTLTSELSQTDITCLLVVYYKF-------SKANGPQCKQMTKKQFYQIF 68
            ||......:..|:.|.:   ....:.::.||:.::|..       ....|..|     ..|..:.
Mouse     1 MEQRALKKMVESIRKTV---KSFKKFEVECLIRLFYSLVGCPVGKMDNTGLDC-----NTFRGVL 57

  Fly    69 LVLFNVASVQVIERTLLAITKD-TKYVSPRAWIHLFDLYTTNDIQVRMRFAFEVYDTKGTGVIDR 132
            ..:|.:.:..::.|......|| ..||:...||....::.....:.:|||.||||...|...|.:
Mouse    58 QNIFGMTNDMLMNRVFFVFDKDGDGYVNLEEWIKGLAVFLRGTFEEKMRFCFEVYYLNGDAYISQ 122

  Fly   133 EQVGTACE-KFFYGEDEDELNELKADMTEFLMKKFDLDKDGVISYEDYSTVVEQQPILVEFLGWL 196
            |::....: ..|....|:|..|...|:.|..:||.|.|.||.||:.|:...|::..:|:|..|  
Mouse   123 EKIFDMLKSSLFQHSPEEENEEGVKDLVEISLKKMDYDNDGKISFADFEKAVKEDGLLLEAFG-- 185

  Fly   197 FPSKEDKDLMAHCINLQLKMN 217
             |...|.....|...|..|.|
Mouse   186 -PCLPDAKFCFHFEALVFKNN 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 24/64 (38%)
EFh 116..178 CDD:238008 23/62 (37%)
1700109H08RikNP_084119.1 EFh 71..130 CDD:298682 17/58 (29%)
EF-hand_7 105..174 CDD:290234 25/68 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.900

Return to query results.
Submit another query.