DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and Chp2

DIOPT Version :10

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_081639.1 Gene:Chp2 / 70261 MGIID:1917511 Length:196 Species:Mus musculus


Alignment Length:34 Identity:10/34 - (29%)
Similarity:16/34 - (47%) Gaps:6/34 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLIVLLALIA------VVVASSYGAQNDYPTDVG 30
            |.::.|.::|      :|.|.|..|:|...|..|
Mouse   192 LCVITLFIVASTYIKIMVAAKSASAENKKSTYKG 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 114..179 CDD:463900
Chp2NP_081639.1 FRQ1 30..184 CDD:444056
Nuclear export signal. /evidence=ECO:0000250 137..148
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.