DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and Chp1

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_077053.1 Gene:Chp1 / 64152 RGDID:620447 Length:195 Species:Rattus norvegicus


Alignment Length:198 Identity:40/198 - (20%)
Similarity:74/198 - (37%) Gaps:45/198 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IKELTLTSELSQTDITCLLVVYYKFSKANGPQCKQMTKKQFYQIFLVLFNVASVQVIE------- 81
            ::|:...:..|.:.||.|   |.:|:..:..:...::::.|.:|..:..|....::|.       
  Rat    14 LEEIKKETGFSHSQITRL---YSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFSEGE 75

  Fly    82 ---------RTLLAI--------TKDTKYVSPRAWIHLFDLYTTNDIQVRMRFAFEVYDTKGTGV 129
                     |||...        :||.....|           .|....::.|||.:||......
  Rat    76 DQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEP-----------LNSRSNKLHFAFRLYDLDKDDK 129

  Fly   130 IDREQVGTACEKFFYGEDEDELNELKADMTEFLMKKFDLDKDGVISYEDYSTVVE----QQPILV 190
            |.|:::.............||.....||.|   :::.|.|.|..||:.::..|:|    :|.:.:
  Rat   130 ISRDELLQVLRMMVGVNISDEQLGSIADRT---IQEADQDGDSAISFTEFVKVLEKVDVEQKMSI 191

  Fly   191 EFL 193
            .||
  Rat   192 RFL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 17/63 (27%)
EFh 116..178 CDD:238008 17/61 (28%)
Chp1NP_077053.1 FRQ1 1..182 CDD:227455 36/184 (20%)
Necessary for association with microtubule and interaction with GAPDH 2..6
Nuclear export signal 1 138..147 0/8 (0%)
Nuclear export signal 2 176..185 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.