DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and ppp3r1a

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_009305321.1 Gene:ppp3r1a / 564337 ZFINID:ZDB-GENE-081113-3 Length:175 Species:Danio rerio


Alignment Length:175 Identity:42/175 - (24%)
Similarity:65/175 - (37%) Gaps:52/175 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 YKFSKANGPQCKQMTK------------KQFYQIFLVLFNVASVQVIERTLLAITKDTKYVSPRA 98
            :|:|....|.| .||.            |:|.:  |.|.|..|:.|.|...|...:....|.   
Zfish     3 HKYSTMGKPLC-GMTSVRFDADEIKRLGKRFKK--LDLDNSGSLSVEEFMSLPELQQNPLVQ--- 61

  Fly    99 WIHLFDLYTTN---------------------DIQVRMRFAFEVYDTKGTGVIDREQVGTACEKF 142
              .:.|::.|:                     |.::::||||.:||....|.|...::.... |.
Zfish    62 --RVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEMKLRFAFRIYDMDKDGYISNGELFQVL-KM 123

  Fly   143 FYGEDEDELNELKADMTEFLMKK----FDLDKDGVISYEDYSTVV 183
            ..|      |.||....:.::.|    .|.|.||.||:|::..||
Zfish   124 MVG------NNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVV 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 21/67 (31%)
EFh 116..178 CDD:238008 20/65 (31%)
ppp3r1aXP_009305321.1 FRQ1 14..162 CDD:227455 36/161 (22%)
EFh 30..85 CDD:238008 12/61 (20%)
EFh 96..162 CDD:238008 21/72 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.