DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and Chp1

DIOPT Version :10

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_062743.1 Gene:Chp1 / 56398 MGIID:1927185 Length:195 Species:Mus musculus


Alignment Length:198 Identity:40/198 - (20%)
Similarity:74/198 - (37%) Gaps:45/198 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IKELTLTSELSQTDITCLLVVYYKFSKANGPQCKQMTKKQFYQIFLVLFNVASVQVIE------- 81
            ::|:...:..|.:.||.|   |.:|:..:..:...::::.|.:|..:..|....::|.       
Mouse    14 LEEIKKETGFSHSQITRL---YSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFSEGE 75

  Fly    82 ---------RTLLAI--------TKDTKYVSPRAWIHLFDLYTTNDIQVRMRFAFEVYDTKGTGV 129
                     |||...        :||.....|           .|....::.|||.:||......
Mouse    76 DQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEP-----------LNSRSNKLHFAFRLYDLDKDDK 129

  Fly   130 IDREQVGTACEKFFYGEDEDELNELKADMTEFLMKKFDLDKDGVISYEDYSTVVE----QQPILV 190
            |.|:::.............||.....||.|   :::.|.|.|..||:.::..|:|    :|.:.:
Mouse   130 ISRDELLQVLRMMVGVNISDEQLGSIADRT---IQEADQDGDSAISFTEFVKVLEKVDVEQKMSI 191

  Fly   191 EFL 193
            .||
Mouse   192 RFL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 114..179 CDD:463900 17/64 (27%)
Chp1NP_062743.1 Necessary for association with microtubule and interaction with GAPDH. /evidence=ECO:0000250 2..6
FRQ1 27..182 CDD:444056 34/171 (20%)
Nuclear export signal 1. /evidence=ECO:0000250 138..147 0/8 (0%)
Nuclear export signal 2. /evidence=ECO:0000250 176..185 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.