Sequence 1: | NP_649671.2 | Gene: | sowi / 40809 | FlyBaseID: | FBgn0037460 | Length: | 217 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001038325.1 | Gene: | efcab1 / 558421 | ZFINID: | ZDB-GENE-040914-40 | Length: | 216 | Species: | Danio rerio |
Alignment Length: | 223 | Identity: | 58/223 - (26%) |
---|---|---|---|
Similarity: | 98/223 - (43%) | Gaps: | 39/223 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 RFAALYGSLIKELTLT-----SELSQTDITCLLVVYYKFSKANGPQCKQMT-----KKQFYQIFL 69
Fly 70 VLFNVASVQVIERTLLAITKDTK-YVSPRAWIHLFDLYTTNDIQVRMRFAFEVYDTKGTGVIDRE 133
Fly 134 QVGTACEKFFYGED-------EDELNELKADMTEFLMKKFDLDKDGVISYEDYSTVVEQQPILVE 191
Fly 192 FLGWLFPSKEDKDLMA----------HC 209 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sowi | NP_649671.2 | EF-hand_7 | 115..179 | CDD:290234 | 26/70 (37%) |
EFh | 116..178 | CDD:238008 | 25/68 (37%) | ||
efcab1 | NP_001038325.1 | EFh | 80..136 | CDD:238008 | 19/61 (31%) |
EF-hand_7 | 80..135 | CDD:290234 | 19/60 (32%) | ||
EFh | 110..176 | CDD:238008 | 26/71 (37%) | ||
EF-hand_7 | 111..178 | CDD:290234 | 27/72 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1331864at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23055 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.980 |