DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and efcab1

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001038325.1 Gene:efcab1 / 558421 ZFINID:ZDB-GENE-040914-40 Length:216 Species:Danio rerio


Alignment Length:223 Identity:58/223 - (26%)
Similarity:98/223 - (43%) Gaps:39/223 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RFAALYGSLIKELTLT-----SELSQTDITCLLVVYYKFSKANGPQCKQMT-----KKQFYQIFL 69
            :.:|:...||:.|..|     ...::|:..||:.:   |:...|.|.::.|     :.:|..|..
Zfish     3 KMSAMNRKLIQNLAETLCRQVKHFNKTETECLIRL---FNSLLGEQAERKTTIGVDRAKFRNILH 64

  Fly    70 VLFNVASVQVIERTLLAITKDTK-YVSPRAWIHLFDLYTTNDIQVRMRFAFEVYDTKGTGVIDRE 133
            ..|.:....:.:|....|.||.. |:|.:.|:....::....:..:|::.|||||..|.|.|.||
Zfish    65 HTFGMTDDMMTDRVCRVIDKDNDGYLSVKEWVEALSVFLRGTLDEKMKYCFEVYDLNGDGYISRE 129

  Fly   134 QVGTACEKFFYGED-------EDELNELKADMTEFLMKKFDLDKDGVISYEDYSTVVEQQPILVE 191
                  |.|...:|       |::.:|...|:.|..:||.|.|.||.:||.|:...|..:.:|:|
Zfish   130 ------EMFQMLKDSLIRQPTEEDPDEGIKDIVEIALKKMDYDHDGRVSYADFEKTVMDENLLLE 188

  Fly   192 FLGWLFPSKEDKDLMA----------HC 209
            ..|...|  :.|.::|          ||
Zfish   189 AFGNCLP--DAKSVLAFEQQAFQKHEHC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 26/70 (37%)
EFh 116..178 CDD:238008 25/68 (37%)
efcab1NP_001038325.1 EFh 80..136 CDD:238008 19/61 (31%)
EF-hand_7 80..135 CDD:290234 19/60 (32%)
EFh 110..176 CDD:238008 26/71 (37%)
EF-hand_7 111..178 CDD:290234 27/72 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331864at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.980

Return to query results.
Submit another query.