DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and efcab1

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001016778.1 Gene:efcab1 / 549532 XenbaseID:XB-GENE-5727529 Length:208 Species:Xenopus tropicalis


Alignment Length:210 Identity:49/210 - (23%)
Similarity:94/210 - (44%) Gaps:21/210 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ENLDATIDSMENSRFAALYGSLIKELTLTSELSQTDITCLLVVYYKF-SKANGPQCKQ-MTKKQF 64
            :||....|::..         |||      ..|:.::..|:.:|:.. .:...|..:: :.:..|
 Frog     4 KNLQKQADALSR---------LIK------HFSKNEVESLIRLYHTLVGRPIDPNTRRGIDRNTF 53

  Fly    65 YQIFLVLFNVASVQVIERTLLAITKDT-KYVSPRAWIHLFDLYTTNDIQVRMRFAFEVYDTKGTG 128
            ..|....|.:....:::|......||. .|:|...|:....::....::.|:::.|.|||..|.|
 Frog    54 RNILHNTFGMTDDMIMDRVFRGFDKDNDSYISVTEWVEGLSVFLRGTLEERIKYCFGVYDLNGDG 118

  Fly   129 VIDREQVGTACEKFFYGE-DEDELNELKADMTEFLMKKFDLDKDGVISYEDYSTVVEQQPILVEF 192
            .|.||::....:.....: .|::.:|...|:.|..:||.|.|.|..:||.|:...|:::.:|:|.
 Frog   119 YISREEMFHMLKNSLLKQPSEEDPDEGVKDLVEIALKKMDYDHDSKLSYMDFEKAVQEENLLLEA 183

  Fly   193 LGWLFPSKEDKDLMA 207
            .|...|  :.|.:||
 Frog   184 FGPCLP--DSKCIMA 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 20/64 (31%)
EFh 116..178 CDD:238008 20/62 (32%)
efcab1NP_001016778.1 EF-hand_7 69..129 CDD:290234 16/59 (27%)
EFh 71..130 CDD:238008 16/58 (28%)
EFh 104..175 CDD:238008 22/70 (31%)
EF-hand_7 105..174 CDD:290234 21/68 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331864at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.