DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and CG5890

DIOPT Version :10

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster


Alignment Length:86 Identity:23/86 - (26%)
Similarity:42/86 - (48%) Gaps:10/86 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 DLYTT------NDIQVRMRFAFEVYDTKGTGVIDR---EQVGTACEKFFYGEDEDELNELKA-DM 158
            ||..|      ..:..|:|:.|::||..|.|.|.|   .::..|..:..........::.|| |.
  Fly   100 DLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPEDDRKARDQ 164

  Fly   159 TEFLMKKFDLDKDGVISYEDY 179
            .:.:.:|.||::||:|:.|::
  Fly   165 VDRVFRKLDLNQDGIITIEEF 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 114..179 CDD:463900 20/68 (29%)
CG5890NP_001356889.1 FRQ1 <80..188 CDD:444056 23/86 (27%)

Return to query results.
Submit another query.