DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and CG5890

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster


Alignment Length:86 Identity:23/86 - (26%)
Similarity:42/86 - (48%) Gaps:10/86 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 DLYTT------NDIQVRMRFAFEVYDTKGTGVIDR---EQVGTACEKFFYGEDEDELNELKA-DM 158
            ||..|      ..:..|:|:.|::||..|.|.|.|   .::..|..:..........::.|| |.
  Fly   100 DLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPEDDRKARDQ 164

  Fly   159 TEFLMKKFDLDKDGVISYEDY 179
            .:.:.:|.||::||:|:.|::
  Fly   165 VDRVFRKLDLNQDGIITIEEF 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 19/67 (28%)
EFh 116..178 CDD:238008 18/65 (28%)
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 23/86 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442298
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.