DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and CG14362

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_650320.1 Gene:CG14362 / 41695 FlyBaseID:FBgn0038186 Length:206 Species:Drosophila melanogaster


Alignment Length:184 Identity:33/184 - (17%)
Similarity:70/184 - (38%) Gaps:33/184 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SRFAALYGSLIKELTLTSELSQTDITCLLVVYYKFSKANGPQCKQMTKKQFYQIFLVL------- 71
            |.:.::...::..|.:.:.||::.|..|.:.:::||.........:.|..||...|.|       
  Fly    10 SSYPSVPQEIMNTLRMNTALSRSQIKYLYIRFHQFSGGGKDPPSHLHKYNFYSGLLQLNPLLPTI 74

  Fly    72 -----FNVASVQVIERTLLAITKDTKYVSPRAWIHLFDLYTTNDIQ-----VRMRFAFEVYDTKG 126
                 .|..::..::..|...|           .....|.|:|:::     .::|..|.:||...
  Fly    75 LNSMFGNKVTITFVDFALFLST-----------FQAHSLKTSNELKNVMMDKKLRLIFNMYDNNK 128

  Fly   127 TGVIDREQVGTACEKFFYGEDEDELNELK-ADMTEFLMKKFDLDKDGVISYEDY 179
            .|.|.:..:.....|.|    .:.|:.:: ..:...:||:.|......|.::|:
  Fly   129 DGRITKYDLVVVVHKLF----SNLLDHVQIMRIVNTIMKEMDHTDSNQIMFQDF 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 13/64 (20%)
EFh 116..178 CDD:238008 13/62 (21%)
CG14362NP_650320.1 EFh 116..183 CDD:238008 14/67 (21%)
EF-hand_7 117..182 CDD:290234 14/66 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.