DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and d-cup

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_650235.1 Gene:d-cup / 41580 FlyBaseID:FBgn0038089 Length:219 Species:Drosophila melanogaster


Alignment Length:206 Identity:78/206 - (37%)
Similarity:135/206 - (65%) Gaps:2/206 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDATIDSMENSRFAALYGSLIKELTLTSELSQTDITCLLVVYYKFSKANGPQCKQMTKKQFYQIF 68
            ||.|::...|.||.::||.|:.::......:.:::||:|::|||:|..|||..:::|..||..|.
  Fly     3 LDLTMNDRFNQRFQSVYGGLVPQIARLVPFNDSEVTCILMIYYKYSLQNGPSARRITSSQFVNIV 67

  Fly    69 LVLFNVASVQVIERTLLAITKDTKYVSPRAWIHLFDLYTTNDIQVRMRFAFEVYDTKGTGVIDRE 133
            :....:..:.|::|.:..|....|:|:|..:::...:..:.|::.:|.||:.|||..|.| |:||
  Fly    68 IGFQQLYDMDVVDRIVTLIAGGRKHVTPMEFVNYMTILMSRDMERKMEFAYMVYDKNGMG-INRE 131

  Fly   134 QVGTACEKFFYGEDEDELNELKADMTEFLMKKFDLDKDGVISYEDYSTVVEQQPILVEFLGWLFP 198
            .:.::.|:||.| |:||:.|::.||.:||:.|||.|:||.||:|:|.::|.|||.|:||||.:||
  Fly   132 IISSSVERFFVG-DDDEVLEMRLDMVDFLLLKFDEDQDGYISFEEYRSIVLQQPRLLEFLGPIFP 195

  Fly   199 SKEDKDLMAHC 209
            |.|.:.::|:|
  Fly   196 SDETRLVVAYC 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 32/63 (51%)
EFh 116..178 CDD:238008 30/61 (49%)
d-cupNP_650235.1 EF-hand_7 114..180 CDD:290234 33/67 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438934
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Homologene 1 1.000 - - H51492
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27167
OrthoDB 1 1.010 - - D106617at6656
OrthoFinder 1 1.000 - - FOG0012682
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7637
98.860

Return to query results.
Submit another query.