DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and CG15177

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_649672.1 Gene:CG15177 / 40810 FlyBaseID:FBgn0037461 Length:225 Species:Drosophila melanogaster


Alignment Length:218 Identity:164/218 - (75%)
Similarity:192/218 - (88%) Gaps:1/218 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MENLDATIDSMENSRFAALYGSLIKELTLTSELSQTDITCLLVVYYKFSKANGPQCKQMTKKQFY 65
            |||||:|:||.|||:|:||||.||||:..||::|..||||||.|||||.:.|||..|||.|.|||
  Fly     1 MENLDSTVDSTENSKFSALYGGLIKEIAATSKMSTLDITCLLCVYYKFVRFNGPGAKQMKKNQFY 65

  Fly    66 QIFLVLFNVASVQVIERTLLAITKDTKYVSPRAWIHLFDLYTTNDIQVRMRFAFEVYDTKGTGVI 130
            ||:|||||||:||||||:||||||||||||||||:.||:||||.|::.||:|||||||||.||||
  Fly    66 QIYLVLFNVANVQVIERSLLAITKDTKYVSPRAWVDLFELYTTEDLERRMKFAFEVYDTKNTGVI 130

  Fly   131 DREQVGTACEKFFY-GEDEDELNELKADMTEFLMKKFDLDKDGVISYEDYSTVVEQQPILVEFLG 194
            ||||||.||||||: |:|||||.||:||||||:|||||:|||||||:||||:||.|||:||||||
  Fly   131 DREQVGVACEKFFHEGDDEDELIELRADMTEFIMKKFDVDKDGVISFEDYSSVVSQQPVLVEFLG 195

  Fly   195 WLFPSKEDKDLMAHCINLQLKMN 217
            |||||.|::|||||.||:...:|
  Fly   196 WLFPSNEERDLMAHVINMDSMLN 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 53/64 (83%)
EFh 116..178 CDD:238008 51/62 (82%)
CG15177NP_649672.1 EF-hand_7 115..180 CDD:290234 53/64 (83%)
EFh 116..179 CDD:298682 51/62 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438926
Domainoid 1 1.000 58 1.000 Domainoid score I17891
eggNOG 1 0.900 - - E2759_KOG0034
Homologene 1 1.000 - - H51492
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1834
OMA 1 1.010 - - QHG27167
OrthoDB 1 1.010 - - D106617at6656
OrthoFinder 1 1.000 - - FOG0012682
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7637
1110.810

Return to query results.
Submit another query.