DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and tesca

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_998493.1 Gene:tesca / 406633 ZFINID:ZDB-GENE-040426-2632 Length:218 Species:Danio rerio


Alignment Length:38 Identity:15/38 - (39%)
Similarity:22/38 - (57%) Gaps:0/38 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 EDELNELKADMTEFLMKKFDLDKDGVISYEDYSTVVEQ 185
            ||:...:|.:...||....|.|.||||:.::|..|||:
Zfish   106 EDKKKTIKEEKLRFLFNMHDTDNDGVITLDEYRRVVEE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 11/30 (37%)
EFh 116..178 CDD:238008 11/29 (38%)
tescaNP_998493.1 FRQ1 12..>144 CDD:227455 15/38 (39%)
EF-hand_8 83..144 CDD:290545 15/38 (39%)
EFh 116..185 CDD:298682 12/28 (43%)
EF-hand_7 117..184 CDD:290234 12/27 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.