DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and tescb

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_991256.1 Gene:tescb / 402993 ZFINID:ZDB-GENE-040426-1903 Length:216 Species:Danio rerio


Alignment Length:100 Identity:25/100 - (25%)
Similarity:44/100 - (44%) Gaps:22/100 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 DLYTTNDIQ---VRMRFAFEVYDTK-----GTGVIDREQVGTACEKFF----------YGEDEDE 150
            ||.|..|::   :|.:.....:|.:     .||.:  :::|  .|:|.          :...|::
Zfish    48 DLKTIQDLESNPIRSQIIEAFFDKRNFQKDATGSV--QEIG--FEEFLTVMSYFRAPAHQITEEQ 108

  Fly   151 LNELKADMTEFLMKKFDLDKDGVISYEDYSTVVEQ 185
            ..|::.....||....|.|.||.|:.|:|..|||:
Zfish   109 REEIRRAKLRFLFNMHDTDNDGTITLEEYRHVVEE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 16/78 (21%)
EFh 116..178 CDD:238008 15/76 (20%)
tescbNP_991256.1 FRQ1 14..>144 CDD:227455 25/99 (25%)
EFh 116..>144 CDD:298682 12/27 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.