DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and Frq2

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster


Alignment Length:82 Identity:21/82 - (25%)
Similarity:37/82 - (45%) Gaps:18/82 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 RFA---FEVYDTKGTGVIDREQVGTACEKFFYGEDEDELNELKADMTEFLMKKFDLDKDGVISYE 177
            :||   |.|:|....|.|:.|:...|......|..:::|:        :..:.:|:|.||.|:.|
  Fly    63 KFASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLH--------WAFRLYDVDNDGYITRE 119

  Fly   178 DYSTVVE-------QQP 187
            :...:|:       |||
  Fly   120 EMYNIVDAIYQMVGQQP 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 17/65 (26%)
EFh 116..178 CDD:238008 16/64 (25%)
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 21/82 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442305
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.