DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and chp2

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_956130.1 Gene:chp2 / 327599 ZFINID:ZDB-GENE-030131-5810 Length:195 Species:Danio rerio


Alignment Length:191 Identity:38/191 - (19%)
Similarity:75/191 - (39%) Gaps:42/191 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SLIKELTLTSELSQT---DITCLLVVYYKFSKANGPQCKQMTKKQFYQIFLVLFNVASVQVIERT 83
            :|:|::....||.|.   ....::.:|.:|...:..:...:..:.|..|..:..|....::|: .
Zfish     7 TLLKKIPNVDELMQETGFSPAHIIRLYERFEALDKERRGHLCPQDFGAIKELAMNPIGDRIID-A 70

  Fly    84 LLAITKDTKYVSPRAWIHLFDLYT------------------------TNDIQVRMRFAFEVYDT 124
            ..:..|||           .|.:|                        .|....:::|||::||.
Zfish    71 FFSPGKDT-----------VDFHTFVKILAHFRPVDKDRPKEPNSPEPINSRSNKLKFAFQLYDQ 124

  Fly   125 KGTGVIDREQVGTACEKFFYGEDEDELNELKADMTEFLMKKFDLDKDGVISYEDYSTVVEQ 185
            ...|.|.|:::..........:..:|..|..||.|   :::.|||:|..||:|::...:|:
Zfish   125 DKDGKISRDELLKVLRDMLGLQVTEEQLESIADRT---IQEADLDRDDAISFEEFRKSLEK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 20/63 (32%)
EFh 116..178 CDD:238008 19/61 (31%)
chp2NP_956130.1 FRQ1 17..178 CDD:227455 35/175 (20%)
EFh 114..178 CDD:238008 20/66 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.