DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and CG44422

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_572699.2 Gene:CG44422 / 32063 FlyBaseID:FBgn0265595 Length:746 Species:Drosophila melanogaster


Alignment Length:183 Identity:44/183 - (24%)
Similarity:77/183 - (42%) Gaps:24/183 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 YKFSKANGPQ--CKQMTKKQFYQIFLVLFNVASVQVIERTLLA------ITKD-TKYVSPRAWIH 101
            |:..||..|.  .|:.|.|..|..|.       .|....||.|      :.:| :..||...::.
  Fly   276 YRGFKAECPTGVVKEDTFKVIYSQFF-------PQGANPTLYAHYVFNTLDQDHSGIVSFEDFVQ 333

  Fly   102 LFDLYTTNDIQVRMRFAFEVYDTKGTGVIDREQ---VGTACEKFFYGEDEDELNE---LKADMTE 160
            ...:.:...::.::|:.|.:||..|.|.|.||:   :.||..:.. |...||..|   :|..: |
  Fly   334 GLSILSRGSVEEKLRWTFSLYDINGDGFITREEMTDIVTAIYELM-GRLPDECPEEEKIKGKV-E 396

  Fly   161 FLMKKFDLDKDGVISYEDYSTVVEQQPILVEFLGWLFPSKEDKDLMAHCINLQ 213
            .:.:|.|.::|||::.|::.........:...:.:..|.:....|.|...:||
  Fly   397 QIFQKMDTNRDGVVTLEEFLEACRNDDAISRSMSYTVPRRRRHQLSAQQQHLQ 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 23/69 (33%)
EFh 116..178 CDD:238008 22/67 (33%)
CG44422NP_572699.2 FRQ1 254..419 CDD:227455 39/151 (26%)
EFh 310..372 CDD:238008 13/61 (21%)
EFh 346..418 CDD:238008 23/73 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.