DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and CG2256

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster


Alignment Length:255 Identity:55/255 - (21%)
Similarity:90/255 - (35%) Gaps:79/255 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IDSMENSRFAALYGSLIKELTLTSELSQTDITCLLVVYYKFSKANGPQCKQMTKKQFYQIFLVLF 72
            :|.:.......|..||.|:...|.:    ::..|..:|.|.                        
  Fly   101 MDELSGKVNPKLLDSLRKKTRFTKD----ELDALCRIYRKL------------------------ 137

  Fly    73 NVASVQVIERTLLAITKDTKYVSPRAWIHLFD-------LYTTNDIQV----------------- 113
             |::.|...:||.:.:.......|.|.:...|       |::|.||..                 
  Fly   138 -VSNCQYAAKTLASSSSSAAIAKPHAAVEGIDRIVFRELLHSTFDIVTEEILMERIFCSWDKAHE 201

  Fly   114 -----------------------RMRFAFEVYDTKGTGVIDREQVGTACEKFFYGEDEDE-LNEL 154
                                   |..|.|.|||....|.|.::::.|........:.:|| .:|.
  Fly   202 GLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYDLNTDGFITKDEMFTLLRNCLIKQPQDEDPDEG 266

  Fly   155 KADMTEFLMKKFDLDKDGVISYEDYSTVVEQQPILVEFLGWLFPSKEDKDLMAHCINLQL 214
            ..|:.|.::|||||||||.:|.||:...|..:|:|:|..|...|:  |..:::....||:
  Fly   267 VKDLVEIVLKKFDLDKDGKVSLEDFMGTVTAEPLLIEAFGQCLPT--DSAVVSFFSTLQV 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 24/64 (38%)
EFh 116..178 CDD:238008 23/62 (37%)
CG2256NP_572437.2 EFh 228..292 CDD:238008 25/63 (40%)
EF-hand_7 229..292 CDD:290234 24/62 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438938
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1834
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D106617at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.