DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and Tescl

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001099703.1 Gene:Tescl / 292706 RGDID:1311676 Length:232 Species:Rattus norvegicus


Alignment Length:137 Identity:32/137 - (23%)
Similarity:56/137 - (40%) Gaps:36/137 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KQFYQIFLVLFNVASVQVIERTLLAITKDTKYVSPRAWIHLFDLYTTNDIQVRMRFAFEVYDTKG 126
            ||.:|.|.:|                :.|...:.|..:.::.|| ..|.|:.|:..||  :|.:.
  Rat    40 KQLHQRFRLL----------------SGDQPTLRPENFDNVLDL-EFNPIRSRIVRAF--FDNRN 85

  Fly   127 TGVIDREQVGTACEKFFYG--------------EDEDELNELKADMTEFLMKKFDLDKDGVISYE 177
            .|   :...|.|.|..|..              .:::|..:.:.:..:||...:|.|.||:|:.:
  Rat    86 LG---KGTSGLAEEITFQDFLTIISYFRPLEPRPNKEEAEQYRKEKMQFLFNMYDQDGDGIITLQ 147

  Fly   178 DYSTVVE 184
            :|..|||
  Rat   148 EYRRVVE 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 16/77 (21%)
EFh 116..178 CDD:238008 16/75 (21%)
TesclNP_001099703.1 PTZ00183 30..206 CDD:185503 32/137 (23%)
EFh 128..>165 CDD:298682 11/27 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.