DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and Kcnip4

DIOPT Version :10

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_852030.1 Gene:Kcnip4 / 259243 RGDID:708539 Length:250 Species:Rattus norvegicus


Alignment Length:192 Identity:40/192 - (20%)
Similarity:71/192 - (36%) Gaps:44/192 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ALYGSLIKELTLTSELSQTDITCLLVVYYKFSKAN--------GPQC-----KQMTKKQFYQIFL 69
            |:..|:..||.:.:...:.:...||....||:|..        ..:|     .:.|.|:.|..|.
  Rat    52 AIQNSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFF 116

  Fly    70 ----------VLFNVASVQVIERTLLAITKDTKY---VSPRAWIHLFDLYTTNDIQVRMRFAFEV 121
                      .|||..              ||.:   ||...:|....:.....:|.::.:||.:
  Rat   117 PQGDSTTYAHFLFNAF--------------DTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNL 167

  Fly   122 YDTKGTGVIDREQVGTACEKFFYGEDEDELNELKADM----TEFLMKKFDLDKDGVISYEDY 179
            ||....|.|.:|::....:..:....:.....||.|.    .|...:|.|.:||||::.:::
  Rat   168 YDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEF 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 114..179 CDD:463900 17/68 (25%)
Kcnip4NP_852030.1 KIS. /evidence=ECO:0000250 2..44
EF-hand_8 99..146 CDD:404678 11/60 (18%)
FRQ1 <128..235 CDD:444056 26/116 (22%)
Interaction with KCND2. /evidence=ECO:0000250|UniProtKB:Q8R426 237..250
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.