DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and chpf-1

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001379127.1 Gene:chpf-1 / 179415 WormBaseID:WBGene00014109 Length:195 Species:Caenorhabditis elegans


Alignment Length:191 Identity:41/191 - (21%)
Similarity:81/191 - (42%) Gaps:40/191 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SRFAAL----YGSLIKELTL-TSELSQTDITCLLV-VYYKFSKANGPQCKQMTKKQFYQIFLVLF 72
            |||.:|    .|.|.::..| ..||:...:...:| .::..:.:||...:|  :..|.|...:|.
 Worm    33 SRFLSLDKKGQGFLSRDDFLNVPELAVNPLGDRIVDAFFTLASSNGDNEEQ--QLNFRQFVRILA 95

  Fly    73 NVASVQVIERTLLAITKDTKYVSPRAWIHLFDLYTTNDIQVRMRFAFEVYDTKGTGVIDREQVGT 137
            :...:..:::..|...||                       ::.|||::||......|.||:...
 Worm    96 HFQPISRVKKNALNSRKD-----------------------KLLFAFKMYDLNKNDYITREEFKV 137

  Fly   138 ACEKFFYGE-DEDELNELKADMTEFLMKKFDLDKDGVISYEDYSTVVE----QQPILVEFL 193
            ......... ..|:|::: ||.|   :::.|.|:||.||::::...:|    ::.:.:.||
 Worm   138 ILNSMVGANITSDQLDKI-ADRT---IEEADADRDGKISFDEFCRAMEKTDIEEKMSIRFL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 19/64 (30%)
EFh 116..178 CDD:238008 19/62 (31%)
chpf-1NP_001379127.1 FRQ1 14..182 CDD:227455 38/177 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.