DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowi and pbo-1

DIOPT Version :9

Sequence 1:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_497601.1 Gene:pbo-1 / 175385 WormBaseID:WBGene00003941 Length:196 Species:Caenorhabditis elegans


Alignment Length:197 Identity:46/197 - (23%)
Similarity:82/197 - (41%) Gaps:55/197 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IKELTLTSELSQTDITCLLVVYYKFSKANGPQCKQ-----MTKKQFYQIFLVLFN---------- 73
            ::.|::.|.||:..|   |.:|.:|......:.|.     :||..|..|..:..|          
 Worm    13 LEHLSIESGLSRGGI---LKLYGRFISLATHRDKTTNEYFLTKGDFQSIAELKQNPLGDRIIDAF 74

  Fly    74 VASVQVIERTLLAITKDTKYVS---------PRAWIHLFDLYTTNDIQVRMRFAFEVYDTKGTGV 129
            .|..:|:||..:......|.:|         |..|         |..:.::||||.:||...:|.
 Worm    75 FADAEVLERRKVYFKDFVKVLSHFRPINKNKPHPW---------NSREAKLRFAFTMYDLNKSGT 130

  Fly   130 IDREQ--------VGTACEKFFYGEDEDELNELKADMTEFLMKKFDLDKDGVISYEDYSTVVEQQ 186
            |.:::        :|.       |..:|::|.: ||.|   |::.|.|.||.|:::::...:|:.
 Worm   131 ITKDEFQDILAMMIGV-------GVPKDQVNSI-ADRT---MREADRDGDGFITFQEFCNAMEKT 184

  Fly   187 PI 188
            .|
 Worm   185 DI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 21/71 (30%)
EFh 116..178 CDD:238008 21/69 (30%)
pbo-1NP_497601.1 EFh 115..181 CDD:238008 21/76 (28%)
EF-hand_7 116..181 CDD:290234 21/75 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.