DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob2 and glob3

DIOPT Version :9

Sequence 1:NP_649669.3 Gene:glob2 / 40807 FlyBaseID:FBgn0250846 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_649597.3 Gene:glob3 / 40726 FlyBaseID:FBgn0037385 Length:196 Species:Drosophila melanogaster


Alignment Length:155 Identity:55/155 - (35%)
Similarity:83/155 - (53%) Gaps:3/155 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YPKPLPDRDLSYKADENEFTMVEKASLRNAWRLIEPFQRRFGKENFYSFLTRNEDLINFFRKDGK 99
            |||.:|........||..||:.|:.:||.||.|:.||:||:|::.|||||......|..||...:
  Fly    18 YPKRIPKIKFGPIKDEMGFTLSERLALRQAWNLVRPFERRYGQDVFYSFLNDYYWGIKKFRNGAE 82

  Fly   100 INLSKLHGHAMAMMKLMSKLVQTLDCNLAFRLALDENLPTHLKNGIDPDYMRMLATALKSYILAS 164
            :|:..||.||:..:.....|::..| .:.|:|.:::|..||.:..:....:..||.||..|:|  
  Fly    83 LNVKALHSHALRFINFFGLLIEEKD-PVVFQLMINDNNHTHNRCHVGSVNIGHLAQALVDYVL-- 144

  Fly   165 SVIENHNSCSLSNGLARLVEIVGEY 189
            .|....:|.||..||::|||....|
  Fly   145 KVFHKVSSPSLEQGLSKLVEKFQNY 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob2NP_649669.3 Mb_like 61..>161 CDD:271266 34/99 (34%)
glob3NP_649597.3 Mb_like 44..169 CDD:271266 45/127 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467593
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I7620
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019708
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.