DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and AT1G50050

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_175427.1 Gene:AT1G50050 / 841429 AraportID:AT1G50050 Length:226 Species:Arabidopsis thaliana


Alignment Length:193 Identity:54/193 - (27%)
Similarity:81/193 - (41%) Gaps:28/193 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FLVNILIVLALCLLVLV--IADLQEDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEK 64
            |....||::|:..|||.  ..:.|:|:||.||..|.:.|...:..|..:.    .||...||..|
plant     4 FKTPFLIIVAISFLVLATNAQNAQQDYLNTHNTARAQVGVANVVWDTVVA----AYATNYANARK 64

  Fly    65 LEHS--SSAGQNYGENLCMRSQ---TPLQCVQDWYDEIADYDFEKPQF---------AMSTGHFT 115
            ::.|  .|.|.:|||||...:.   |.:..|..|.:       |||.:         |....|:|
plant    65 VDCSLTPSTGGSYGENLANGNNALFTGVAAVNLWVN-------EKPYYNYTANACIGAQQCKHYT 122

  Fly   116 ALVWKNAKKMGIGQAKDKKGYYWVVARYYPPVNVNGQFEENVLPPIKGEGDENGQGNL-NRFQ 177
            .:||.|:.|:|..:.....|.|:|...|.....:..:.....:...:|.|.....|.| |:||
plant   123 QVVWSNSVKIGCARVLCNNGGYFVGCNYDASAALKSRKITASVRQTRGLGASAACGQLRNKFQ 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 40/141 (28%)
AT1G50050NP_175427.1 SCP 27..151 CDD:294090 39/134 (29%)
Radical_SAM <155..185 CDD:302752 5/29 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H130828
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.830

Return to query results.
Submit another query.