DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and AT1G01310

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_171638.2 Gene:AT1G01310 / 839333 AraportID:AT1G01310 Length:241 Species:Arabidopsis thaliana


Alignment Length:172 Identity:49/172 - (28%)
Similarity:72/172 - (41%) Gaps:32/172 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNE----KLEHSSSAGQNYGENLCMRSQ- 84
            :.|..||.:|.:.|.||...|..|.    .||:..||..    :|.||:..   ||||:....: 
plant    87 EFLIAHNLVRARVGEPPFQWDGRLA----AYARTWANQRVGDCRLVHSNGP---YGENIFWAGKN 144

  Fly    85 --TPLQCVQDWYDEIADYDFE----KPQFAMSTGHFTALVWKNAKKMGIGQAKDKKGYYWVVARY 143
              :|...|..|.||...||.:    :||.  ..||:|.:||:::.|:|........|..:.:..|
plant   145 NWSPRDIVNVWADEDKFYDVKGNTCEPQH--MCGHYTQIVWRDSTKVGCASVDCSNGGVYAICVY 207

  Fly   144 YPPVNVNGQFEENVLPPIKGEGDENGQGNLNRFQVDNIPIIV 185
            .||.|..|   ||   |.....|:.|...      |:.|.::
plant   208 NPPGNYEG---EN---PFGSYDDQIGLAR------DDPPAVI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 40/134 (30%)
AT1G01310NP_171638.2 SCP_PR-1_like 87..219 CDD:240181 44/146 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.