DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and AT5G66590

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_201460.1 Gene:AT5G66590 / 836791 AraportID:AT5G66590 Length:185 Species:Arabidopsis thaliana


Alignment Length:130 Identity:39/130 - (30%)
Similarity:58/130 - (44%) Gaps:7/130 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 HNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHSSSAGQNYGENLC----MRSQTPLQCV 90
            ||:.|...|.|||.....|.......|:...|.:|.|.:|.....||.|..    :.:.||...|
plant    53 HNKARAMVGVPPLVWSQTLEAAASRLARYQRNQKKCEFASLNPGKYGANQLWAKGLVAVTPSLAV 117

  Fly    91 QDWYDEIADYDFEKPQFAM--STGHFTALVWKNAKKMGIGQAK-DKKGYYWVVARYYPPVNVNGQ 152
            :.|..|...|:::....|.  :.|.:..:||:|:|::|..||. .|:.....:..|.||.||.||
plant   118 ETWVKEKPFYNYKSDTCAANHTCGVYKQVVWRNSKELGCAQATCTKESTVLTICFYNPPGNVIGQ 182

  Fly   153  152
            plant   183  182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 35/125 (28%)
AT5G66590NP_201460.1 CAP_PR-1 46..185 CDD:349400 39/130 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.