DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and AT5G57625

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_680450.1 Gene:AT5G57625 / 835867 AraportID:AT5G57625 Length:207 Species:Arabidopsis thaliana


Alignment Length:136 Identity:44/136 - (32%)
Similarity:60/136 - (44%) Gaps:17/136 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEK----LEHSSSAGQNYGENLCM---RSQ 84
            |:.||.||...|.|||..|.:|.    .||...||..:    |.||:..   |||||..   .|.
plant    76 LDPHNALRSGLGLPPLIWDGKLA----SYATWWANQRRYDCSLTHSTGP---YGENLFWGSGSSW 133

  Fly    85 TPLQCVQDWYDEIADYDFEKPQFAMS--TGHFTALVWKNAKKMGIGQAKDKKGY-YWVVARYYPP 146
            .|...||.|..|...|:........|  .||:|.:||::.|::|..:...:.|. .::...|.||
plant   134 APGFAVQSWIVEGRSYNHNTNSCDGSGMCGHYTQMVWRDTKRLGCARVVCENGAGVFITCNYDPP 198

  Fly   147 VNVNGQ 152
            .|..|:
plant   199 GNYVGE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 42/131 (32%)
AT5G57625NP_680450.1 CAP_PR-1 72..207 CDD:349400 44/136 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.830

Return to query results.
Submit another query.