DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and AT5G02730

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_195893.1 Gene:AT5G02730 / 831820 AraportID:AT5G02730 Length:205 Species:Arabidopsis thaliana


Alignment Length:135 Identity:40/135 - (29%)
Similarity:63/135 - (46%) Gaps:10/135 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHSSSAGQNYGENL--CMRSQ--T 85
            :.|..||..|...|:..|..|..|.:...::||...::.|:.||   |..||||:  ..||:  :
plant    59 EFLLAHNAARVASGASNLRWDQGLARFASKWAKQRKSDCKMTHS---GGPYGENIFRYQRSENWS 120

  Fly    86 PLQCVQDWYDEIADYD--FEKPQFAMSTGHFTALVWKNAKKMGIGQAK-DKKGYYWVVARYYPPV 147
            |.:.|..|.||..:||  ....:.....||:|.:||:....:|..::| |....:.|:..|.|..
plant   121 PRRVVDKWMDESLNYDRVANTCKSGAMCGHYTQIVWRTTTAVGCARSKCDNNRGFLVICEYSPSG 185

  Fly   148 NVNGQ 152
            |..|:
plant   186 NYEGE 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 38/130 (29%)
AT5G02730NP_195893.1 SCP_PR-1_like 57..193 CDD:240181 40/135 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.