DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and AT4G30320

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_194761.1 Gene:AT4G30320 / 829155 AraportID:AT4G30320 Length:161 Species:Arabidopsis thaliana


Alignment Length:155 Identity:46/155 - (29%)
Similarity:65/155 - (41%) Gaps:18/155 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLALCLLVLV--IADLQEDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEK----LEH 67
            :.|:.|||..  .|..||..:...|..|......||..|.:|.:    ||:..||..:    |.|
plant    11 ITAMMLLVTCCHCATYQEQFMGPQNAARAHLRLKPLKWDAKLAR----YAQWWANQRRGDCALTH 71

  Fly    68 SSSAGQNYGENLCMRSQT---PLQCVQDWYDEIADYDFEKPQF-AMSTGHFTALVWKNAKKMGIG 128
            |:..   |||||...|..   |.|....|..|...|::..... :...||:|.:||||.:|:|..
plant    72 SNGP---YGENLFWGSGNRWGPSQAAYGWLSEARSYNYRSNSCNSEMCGHYTQIVWKNTQKIGCA 133

  Fly   129 QA-KDKKGYYWVVARYYPPVNVNGQ 152
            .. .:..|..::...|.||.|..|:
plant   134 HVICNGGGGVFLTCNYDPPGNFLGR 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 39/136 (29%)
AT4G30320NP_194761.1 CAP_PR-1 27..161 CDD:349400 41/139 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.