DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and AT4G07820

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_192524.1 Gene:AT4G07820 / 826263 AraportID:AT4G07820 Length:160 Species:Arabidopsis thaliana


Alignment Length:152 Identity:37/152 - (24%)
Similarity:64/152 - (42%) Gaps:17/152 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIVLALCLLV-----LVIADLQEDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLE 66
            |:|||:.|.:     |...|..:|:.|.|||.|...|..||.....||...:.||      ||..
plant     8 LLVLAIALALSFSVPLKAQDQPQDYFNAHNRARVSVGVSPLMWSQTLTAYAQAYA------EKRR 66

  Fly    67 HSS--SAGQNYGENL--CMRSQTPLQCVQDWYDEIADYDF--EKPQFAMSTGHFTALVWKNAKKM 125
            ...  .:|..|||.:  .:...:..:.|..:.::.:|||:  ...:...|...:..::::.:..:
plant    67 DCGLFLSGGPYGETIKADIIDFSAEEFVSTFLNQKSDYDYTTNTCRAGKSCDGYKQVLFRKSVFL 131

  Fly   126 GIGQAKDKKGYYWVVARYYPPV 147
            |..:.|...|.:..:..|.|.|
plant   132 GCAKVKCNNGGFLAICSYDPSV 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 31/133 (23%)
AT4G07820NP_192524.1 CAP_PR-1 29..160 CDD:349400 30/131 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.830

Return to query results.
Submit another query.