DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and AT3G19690

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_188603.1 Gene:AT3G19690 / 821506 AraportID:AT3G19690 Length:161 Species:Arabidopsis thaliana


Alignment Length:155 Identity:49/155 - (31%)
Similarity:72/155 - (46%) Gaps:10/155 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NILIVLALCLLVLVIA-DLQEDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHS 68
            |||.:||:.|....:| |||:..|..||..|.:.|..||..|||:......||....|:..|.||
plant     7 NILFLLAIALFYGSLAEDLQQQFLEAHNEARNEVGLDPLVWDDEVAAYAASYANQRINDCALVHS 71

  Fly    69 SSAGQNYGENLCMRS--QTPLQCVQDWYDEIADYDFEKPQFAMSTG----HFTALVWKNAKKMGI 127
            :..   :|||:.|.|  .:.....:.|.:|...||::........|    |:|.:||||..::|.
plant    72 NGP---FGENIAMSSGEMSAEDAAEMWINEKQYYDYDSNTCNDPNGGTCLHYTQVVWKNTVRLGC 133

  Fly   128 GQAKDKKGYYWVVARYYPPVNVNGQ 152
            .:.....|..::...|.||.|..|:
plant   134 AKVVCNSGGTFITCNYDPPGNYIGE 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 40/133 (30%)
AT3G19690NP_188603.1 CAP_PR-1 26..161 CDD:349400 40/136 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H130828
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.