DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and AT3G09590

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_187570.1 Gene:AT3G09590 / 820116 AraportID:AT3G09590 Length:186 Species:Arabidopsis thaliana


Alignment Length:140 Identity:42/140 - (30%)
Similarity:66/140 - (47%) Gaps:10/140 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ADLQEDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHSSSAGQNYGENLC---- 80
            |.|..:.|..||..|...|.|.|..|.:|.:..:::||...::..:.||   |..||||:.    
plant    47 AKLSREFLQAHNDARVSSGVPTLGWDRDLARFADKWAKQRKSDCSMIHS---GGPYGENIFWHRR 108

  Fly    81 MRSQTPLQCVQDWYDEIADYDFEKPQFA--MSTGHFTALVWKNAKKMGIGQAKDKKGY-YWVVAR 142
            .::.:|.:.|..|::|..:||.:....|  ...||:|.:||:....:|..:.|...|. |.||..
plant   109 KKTWSPEKVVTRWFEERFNYDVKTNTCAPGKMCGHYTQMVWRETTAVGCARVKCHNGRGYLVVCE 173

  Fly   143 YYPPVNVNGQ 152
            |.|..|..|:
plant   174 YDPRGNYEGE 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 39/134 (29%)
AT3G09590NP_187570.1 CAP_PR-1 50..186 CDD:349400 40/137 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.