DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and PR-1-LIKE

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_179589.1 Gene:PR-1-LIKE / 816518 AraportID:AT2G19990 Length:176 Species:Arabidopsis thaliana


Alignment Length:140 Identity:39/140 - (27%)
Similarity:65/140 - (46%) Gaps:20/140 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHSSSAGQNYGENLCMRSQT--- 85
            ::.|..||:.|...|..|:..::.|....:.||...|.:..::||...   :||||.....|   
plant    43 QETLVVHNKARAMVGVGPMVWNETLATYAQSYAHERARDCAMKHSLGP---FGENLAAGWGTMSG 104

  Fly    86 PLQCVQDWYDEIADYDFEKPQFAMST-------GHFTALVWKNAKKMGIGQAKDKKG-YYWVVAR 142
            |: ..:.|..|..:||::.     :|       ||:|.:||:::.::|....:.|.. |.||:..
plant   105 PV-ATEYWMTEKENYDYDS-----NTCGGDGVCGHYTQIVWRDSVRLGCASVRCKNDEYIWVICS 163

  Fly   143 YYPPVNVNGQ 152
            |.||.|..||
plant   164 YDPPGNYIGQ 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 36/135 (27%)
PR-1-LIKENP_179589.1 CAP_PR-1 42..176 CDD:349400 39/140 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H130828
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.