DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and AT2G19980

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_179588.1 Gene:AT2G19980 / 816517 AraportID:AT2G19980 Length:165 Species:Arabidopsis thaliana


Alignment Length:156 Identity:40/156 - (25%)
Similarity:66/156 - (42%) Gaps:28/156 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IVLALCLLVLV----------IADLQ-EDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLAN 61
            |||.|..:||.          :.||| .:.|..||::|        ..|.:|....:.||.|.:.
plant     9 IVLTLLSIVLTQIYGLRSFSRMDDLQPAETLAVHNQIR--------AADQKLAAHAQRYANVRSQ 65

  Fly    62 NEKLEHSSSAGQNYGENLCMRSQTPLQCVQD------WYDEIADYDFEKPQFAMSTGHFTALVWK 120
            :..:::|:..  .||||:......|:..:..      |:.|...|::...:.:...||:|.:|..
plant    66 DCAMKYSTDG--TYGENIAAGWVQPMDTMSGPIATKFWFTEKPYYNYATNKCSEPCGHYTQIVAN 128

  Fly   121 NAKKMGIGQAK-DKKGYYWVVARYYP 145
            .:..:|.|..: .|..|.|||..|.|
plant   129 QSTHLGCGTVRCFKNEYVWVVCNYAP 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 34/133 (26%)
AT2G19980NP_179588.1 SCP 35..165 CDD:294090 31/130 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H130828
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.