DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and AT2G19970

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_179587.1 Gene:AT2G19970 / 816516 AraportID:AT2G19970 Length:177 Species:Arabidopsis thaliana


Alignment Length:176 Identity:46/176 - (26%)
Similarity:70/176 - (39%) Gaps:31/176 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVNILIVLALCL-LVLVIADLQ-EDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNE-- 63
            |:::|:..|..| .|..|.|:| ...|..||::|...|..||    :..|....||:..||.:  
plant    13 LLSVLLTRAYGLPRVRPIKDVQPRKTLKVHNQIRAAVGVAPL----KWNKTVAAYAQKFANRQAK 73

  Fly    64 -------KLEHSSSAGQNYGENLCMRSQTPLQ------CVQDWYDEIADYDFEKPQFAMSTGHFT 115
                   .:.||...   ||||:......|..      ..:.|..|..:||....:.....||:|
plant    74 AGVCDYSSMRHSDGP---YGENIAAGWVQPKDQMSGPIAAKYWLTEKPNYDHATNKCKDVCGHYT 135

  Fly   116 ALVWKNAKKMGIGQAK-DKKGYYWVVARYYP-PVNVNGQFEENVLP 159
            .:|...:..:|.|..: .:....::|..||| ||.     :||..|
plant   136 QMVANQSLSLGCGSFRCHENELIYIVCNYYPMPVG-----DENTRP 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 37/145 (26%)
AT2G19970NP_179587.1 CAP_PR-1 35..177 CDD:349400 38/154 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H130828
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.830

Return to query results.
Submit another query.