DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and PRB1

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_179064.1 Gene:PRB1 / 815945 AraportID:AT2G14580 Length:161 Species:Arabidopsis thaliana


Alignment Length:153 Identity:47/153 - (30%)
Similarity:75/153 - (49%) Gaps:9/153 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILIVLALCLLVLVI----ADLQEDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLE 66
            |||:||..:..||:    .|.|:|::|.||:.|.:.|..|:..|:.|......||..|..:.:|.
plant     9 ILIILAALVGALVVPLKAQDSQQDYVNAHNQARSQIGVGPMQWDEGLAAYARNYANQLKGDCRLV 73

  Fly    67 HSSSAGQNYGENLCMR--SQTPLQCVQDWYDEIADYDFEKPQFAMSTGHFTALVWKNAKKMGIGQ 129
            ||...   |||||...  ..:.:..|..|.:|.|:|:::........||:|.:||:|:.::|..:
plant    74 HSRGP---YGENLAKSGGDLSGVAAVNLWVNEKANYNYDTNTCNGVCGHYTQVVWRNSVRLGCAK 135

  Fly   130 AKDKKGYYWVVARYYPPVNVNGQ 152
            .:...|...:...|.||.|...|
plant   136 VRCNNGGTIISCNYDPPGNYANQ 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 38/129 (29%)
PRB1NP_179064.1 CAP_PR-1 30..161 CDD:349400 39/132 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H130828
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3501
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.