DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and Crisp4

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001333976.1 Gene:Crisp4 / 78081 MGIID:1925331 Length:293 Species:Mus musculus


Alignment Length:158 Identity:41/158 - (25%)
Similarity:65/158 - (41%) Gaps:21/158 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QEDHLNEHNRLREKHGSPPL--TLDDELTKGCEEYAKVLANNEKLEHSSSAGQNY-----GENLC 80
            ||:.:|.||..|.| .|||.  .|....:....|.|::||.......|.|..:..     |||:.
Mouse    85 QEEIVNTHNAFRRK-VSPPARNMLKVSWSSAAAENARILARYCDKSDSDSLERRLPNTFCGENML 148

  Fly    81 MR--SQTPLQCVQDWYDEIADYDF-EKPQF--AMSTGHFTALVWKNAKKMGIGQA---KDKKGYY 137
            |.  ..:..:.::.|::|...:.: |.|..  .:.|.|:|.:||.:...:|...|   :.|...|
Mouse   149 MEHYPSSWSKVIEIWFNESKYFKYGEWPSTDDDIETDHYTQMVWASTYLVGCDVAACRRQKAATY 213

  Fly   138 WVVARYYPPVNVNGQFEENVLPPIKGEG 165
            ..|..|..    .|..::.:..|.| ||
Mouse   214 LYVCHYCH----EGNHQDTLNMPYK-EG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 36/140 (26%)
Crisp4NP_001333976.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.