DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and Glipr2

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_006238202.1 Gene:Glipr2 / 679819 RGDID:1583669 Length:170 Species:Rattus norvegicus


Alignment Length:142 Identity:69/142 - (48%)
Similarity:88/142 - (61%) Gaps:7/142 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHS--SSAGQNYGENLCMRS--QTPL 87
            |..||..|.|||.|||.|..:|.:..::|::.||:...|:||  ||.|| .||||...|  ||..
  Rat    30 LKAHNEYRAKHGVPPLKLCKKLNQEAQQYSEALASTRILKHSPESSRGQ-CGENLAWASYDQTGK 93

  Fly    88 QCVQDWYDEIADYDFEKPQFAMSTGHFTALVWKNAKKMGIGQAKDKKGYYWVVARYYPPVNV--N 150
            :....||.||..|:|::|.|...||||||:||||.||:|:|:|....|..:|||||:|..|:  .
  Rat    94 EVADRWYSEIKSYNFQQPGFTSGTGHFTAMVWKNTKKIGVGKASASDGSSFVVARYFPAGNIVNQ 158

  Fly   151 GQFEENVLPPIK 162
            |.|||||.||.|
  Rat   159 GFFEENVPPPKK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 59/125 (47%)
Glipr2XP_006238202.1 SCP_GAPR-1_like 24..155 CDD:240182 59/125 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351049
Domainoid 1 1.000 102 1.000 Domainoid score I6733
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I4599
OMA 1 1.010 - - QHG49417
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - oto97798
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.