DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and Glipr1l2

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_080499.1 Gene:Glipr1l2 / 67537 MGIID:1914787 Length:332 Species:Mus musculus


Alignment Length:155 Identity:40/155 - (25%)
Similarity:65/155 - (41%) Gaps:35/155 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VNILIVLALCLLVLVIA--------DLQE--DHLNE----HNRLREKHGS--PP------LTLDD 46
            |.:..||.||.|.|::.        .|:|  |.:||    ||.||   |:  ||      :|.|.
Mouse    18 VRLRRVLKLCELWLLLVGSGLNAKLPLEEDVDFINEYVGLHNELR---GTVFPPGVNLRFMTWDV 79

  Fly    47 ELTKGCEEYAK--VLANN---EKLEHSSSAGQNYGENLC---MRSQTPLQCVQDWYDEIADYDFE 103
            .|::....:.|  :.:.|   :||..|.......|||:.   :...|....::.|::|...|.:.
Mouse    80 ALSRTARAWGKKCMYSRNTHLDKLHESHPVFTEIGENMWVGPVEDFTVTTAIRSWHEERKSYSYL 144

  Fly   104 KPQFA--MSTGHFTALVWKNAKKMG 126
            .....  .:..|:..|||.::.|:|
Mouse   145 NDTCVEDQNCSHYIQLVWDSSYKVG 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 33/130 (25%)
Glipr1l2NP_080499.1 SCP 49..194 CDD:294090 31/124 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.