DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and Crisp1

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001034482.2 Gene:Crisp1 / 654517 RGDID:1590757 Length:254 Species:Rattus norvegicus


Alignment Length:157 Identity:40/157 - (25%)
Similarity:67/157 - (42%) Gaps:22/157 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QEDHLNEHNRLREKHGSPPL--TLDDELTKGCEEYAKVLANNEKLEHSSSAGQNY-----GENLC 80
            ||:.::.||..| ::.|||.  .|....:....|.|::||.......|.|..:..     |||:.
  Rat    46 QEEIVDTHNAFR-RNVSPPARNMLKMSWSSAAAENARILARYCDKSDSDSLERRLPNTFCGENMH 109

  Fly    81 MRS--QTPLQCVQDWYDEIADYDF-EKPQF--AMSTGHFTALVWKNAKKMGIGQA---KDKKGYY 137
            |.:  .:....::.||:|...:.: |.|..  .:.|.|:|.:||.::..:|...|   :.|...|
  Rat   110 MENYPSSWSNVIEIWYNESKYFKYGEWPSTDDDIETYHYTQMVWASSYLIGCDVASCRRQKAATY 174

  Fly   138 WVVARYYPPVN----VNGQFEENVLPP 160
            ..|..|....|    :|..::|.  ||
  Rat   175 LYVCHYCHEGNSQDTLNMPYKEG--PP 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 36/144 (25%)
Crisp1NP_001034482.2 SCP 46..182 CDD:294090 35/136 (26%)
Crisp 200..254 CDD:285731 40/157 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.