DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and Crisp3

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_074050.1 Gene:Crisp3 / 64827 RGDID:619846 Length:246 Species:Rattus norvegicus


Alignment Length:202 Identity:53/202 - (26%)
Similarity:90/202 - (44%) Gaps:34/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLVNILIVLALCLLVLVIAD------------------LQEDHLNEHNRLR---EKHGSPPLTL 44
            |.|:.:|:.||..|...::.|                  :||:.:|:||:||   ...||..|.:
  Rat     1 MALMLVLLFLAAVLPPSLLQDTTDEWDRDLENLSTTKLSVQEEIINKHNQLRRTVSPSGSDLLRV 65

  Fly    45 --DDELTKGCEEYA-KVLANNEKLEHSSSAGQNYGENLCMRSQTP--LQCVQDWYDEIAD--YDF 102
              |.:.....:::| :.:.|:..|:|.::. ...||||.|.:...  ...:||||||..|  :.|
  Rat    66 EWDHDAYVNAQKWANRCIYNHSPLQHRTTT-LKCGENLFMANYPASWSSVIQDWYDESLDFVFGF 129

  Fly   103 EKPQFAMSTGHFTALVWKNA--KKMGIGQAKDKKGYYWVVARYYPPVNVNGQFEENVLPPIKGEG 165
            ...:..:..||:|.:||.:.  ...|:.:..|:...|:.|..|.|..|..|:...   |..:||.
  Rat   130 GPKKVGVKVGHYTQVVWNSTFLVACGVAECPDQPLKYFYVCHYCPGGNYVGRLYS---PYTEGEP 191

  Fly   166 DENGQGN 172
            .::..||
  Rat   192 CDSCPGN 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 40/157 (25%)
Crisp3NP_074050.1 SCP_CRISP 39..174 CDD:240183 38/135 (28%)
Crisp 192..246 CDD:285731 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.