DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and crispl

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001025526.1 Gene:crispl / 594930 XenbaseID:XB-GENE-5768874 Length:314 Species:Xenopus tropicalis


Alignment Length:196 Identity:51/196 - (26%)
Similarity:77/196 - (39%) Gaps:43/196 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DLQEDH---LNEHNRLREKHGSPP-----LTLDDELTKGCEEYAKVLANNEKLEHS-----SSAG 72
            ||:.:.   ||.||.||.....||     :...|...|...::    ||:.|..||     :..|
 Frog   103 DLESNRQSILNVHNELRRNANPPPSNMLKMVWSDLAAKSAAKW----ANSCKQYHSLKPERTIPG 163

  Fly    73 QNYGENLCMRSQTPL--QCVQDWYDEIADYDFEK--PQFAMSTGHFTALVWKNAKKMGIGQAK-- 131
            .:.||||.|.|....  ..::.:|.||.|:.:.|  .:..:...|||.::|.::..:|...|:  
 Frog   164 FSCGENLFMASYKASWEDVIRAFYSEIEDFLYGKGAKEVGLQILHFTQVMWFSSWLVGCAAAQCP 228

  Fly   132 --DKKGYYWVVARYYPPVNVNGQFEENVLPPIK-GEGDE------------NGQGNLNRFQVDNI 181
              |....::.|..|.|..|..     ||..|.| |:..|            ||....|:|...:.
 Frog   229 ITDHSLEFYFVCHYAPAGNYG-----NVGIPYKTGKPCEDCKSSCENGLCTNGCNFQNKFSNCDT 288

  Fly   182 P 182
            |
 Frog   289 P 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 39/148 (26%)
crisplNP_001025526.1 CAP_CRISP 106..245 CDD:349402 36/142 (25%)
Crisp 261..314 CDD:369954 6/29 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.